Antibodies

Jump to Filters
View as table Download
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA890005

USD 407.00

4 Weeks

Rabbit polyclonal HNF1B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B.
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA890005S

USD 188.00

In Stock

Rabbit polyclonal HNF1B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B.

Special Offer: Get this product for $99/€99. Use code: "Truesample".

HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA332360

USD 539.00

5 Days

Rabbit Polyclonal Anti-HNF1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HNF1B Antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: NFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYD
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA321136

USD 380.00

In Stock

Anti-HNF1B Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 36-50 amino acids of human HNF1 homeobox B
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA330246

USD 539.00

5 Days

Rabbit Polyclonal Anti-HNF1B Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA330247

USD 485.00

5 Days

Rabbit Polyclonal Anti-HNF1B Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA334721

USD 539.00

5 Days

Rabbit Polyclonal Anti-HNF1B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the C terminal of human HNF1B. Synthetic peptide located within the following region: QGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMIS
HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
TA347848

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-HNF-1β(TCF-2) Antibody 

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF-1β(TCF-2) Antibody: Peptide sequence around aa.252~256(R-Q-K-N-P) derived from Human HNF-1b(TCF-2).