Antibodies

Jump to Filters
View as table Download
NFS1 (Center) Rabbit Polyclonal Antibody
AP52867PU-N

USD 580.00

2 Weeks

NFS1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 120-149aa) of human NFS1
NFS1 Rabbit Polyclonal Antibody
TA331805

USD 485.00

5 Days

Rabbit Polyclonal Anti-NFS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NFS1 Antibody: synthetic peptide directed towards the middle region of human NFS1. Synthetic peptide located within the following region: TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV