Antibodies

Jump to Filters
View as table Download
CHSY3 Rabbit Polyclonal Antibody
AP01393PU-N

USD 465.00

3 Weeks

CHSY3 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 640-690 of Human CHSY2.
CHPF Rabbit Polyclonal Antibody
TA315791

USD 380.00

In Stock

Rabbit polyclonal anti-CHPH (CHSS2) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHSS2.
CHST11 Rabbit Polyclonal Antibody
TA342376

USD 539.00

5 Days

Rabbit Polyclonal Anti-Chst11 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Chst11 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS