Antibodies

View as table Download

Anti-CCR8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human chemokine (C-C motif) receptor 8

Rabbit polyclonal IL8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8.

Rabbit Polyclonal Anti-ADCY3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ADCY3

Rabbit Polyclonal CCR5 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5.

Rabbit Polyclonal Anti-CCR6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CCR6

Rabbit Polyclonal Eotaxin Antibody

Applications ELISA, ICC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Eotaxin antibody was raised in rabbits against a peptide corresponding to amino acids near the carboxy terminus of human eotaxin.

Rabbit Polyclonal CXCR4-Lo Antibody

Applications ELISA, ICC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CXCR4-Lo antibody was raised against a peptide corresponding to nine amino acids near the amino terminus of human CXCR4 isoform a.

Rabbit Polyclonal CCR7 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CCR7 antibody was raised against a 15 amino acid peptide near the center of human CCR7.

Rabbit Polyclonal CCL4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal CCL4 antibody was raised against a 15 amino acid peptide near the center of human CCL4.

Anti-CCR8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 175-191 amino acids of Human C-C chemokine receptor type 8

CX3CR1 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide corresponding to amino acids 2-21 of Human CX3CR1.

Rabbit polyclonal anti-CCR7 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CCR7.

Anti-CCR3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 10-25 amino acids of human chemokine (C-C motif) receptor 3

Rabbit anti-CXCR3 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CXCR3

Rabbit Polyclonal Anti-ADCY6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY