Antibodies

Jump to Filters
View as table Download
MNAT1 Rabbit Polyclonal Antibody
TA314210

USD 380.00

In Stock

Rabbit polyclonal anti-MAT1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAT1.
MNAT1 Rabbit Polyclonal Antibody
AP06703PU-N

USD 465.00

3 Weeks

MNAT1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 100-150 of Human MNAT1.
MNAT1 Rabbit Polyclonal Antibody
TA327211

USD 365.00

3 Weeks

MNAT1 Rabbit Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MNAT1
MNAT1 Rabbit Polyclonal Antibody
TA330174

USD 539.00

5 Days

Rabbit Polyclonal Anti-MNAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MNAT1 antibody: synthetic peptide directed towards the N terminal of human MNAT1. Synthetic peptide located within the following region: DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGT
MNAT1 Rabbit Polyclonal Antibody
TA335831

USD 485.00

5 Days

Rabbit Polyclonal Anti-MNAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MNAT1 Antibody: synthetic peptide directed towards the C terminal of human MNAT1. Synthetic peptide located within the following region: LQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA