Rabbit Polyclonal Lipase A Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an internal region of the human Lysosomal acid lipase protein (within residues 150-300). [Swiss-Prot P38571] |
Rabbit polyclonal CYP27B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP27B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 482-508 amino acids from the C-terminal region of human CYP27B1. |
Rabbit Polyclonal Anti-SQLE Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE |
Squalene Epoxidase (SQLE) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 67-97aa) of human Squalene epoxidase / SQLE |
Rabbit Polyclonal Anti-LIPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LIPA antibody: synthetic peptide directed towards the N terminal of human LIPA. Synthetic peptide located within the following region: SYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLAD |
Rabbit Polyclonal Anti-LSS Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSS antibody: synthetic peptide directed towards the N terminal of human LSS. Synthetic peptide located within the following region: TEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGL |
Rabbit Polyclonal Anti-DHCR24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DHCR24 antibody: synthetic peptide directed towards the N terminal of human DHCR24. Synthetic peptide located within the following region: FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK |
Rabbit Polyclonal Anti-CYP51A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP51A1 antibody: synthetic peptide directed towards the N terminal of human CYP51A1. Synthetic peptide located within the following region: TYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQ |
Rabbit Polyclonal Anti-HSD17B7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human HSD17B7 |
HSD17B7 (N-term) rabbit polyclonal antibody
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human HSD17B7 |
Bile salt activated lipase (CEL) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 453-482 amino acids from the Central region of human CEL |
Germany
Japan
United Kingdom
China
