Antibodies

Jump to Filters
View as table Download
DPAGT1 Rabbit Polyclonal Antibody
TA319635

USD 570.00

5 Days

Rabbit Polyclonal DPAGT1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DPAGT1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human DPAGT1.
ALG9 Rabbit Polyclonal Antibody
TA323315

USD 380.00

In Stock

Anti-ALG9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 427-611 amino acids of human ALG9, alpha-1,2-mannosyltransferase
FUT8 Rabbit Polyclonal Antibody
TA351201

USD 380.00

Backordered

Rabbit Polyclonal Anti-FUT8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FUT8
Ribophorin I (RPN1) Rabbit Polyclonal Antibody
TA349562

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-RPN1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RPN1
CDw75 (ST6GAL1) Rabbit Polyclonal Antibody
TA314536

USD 380.00

In Stock

Rabbit polyclonal anti-ST6GAL1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ST6GAL1.
alpha Glucosidase II (GANAB) Rabbit Polyclonal Antibody
TA308534

USD 625.00

5 Days

Rabbit Polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 47 and 251 of alpha Glucosidase II
MGAT3 Rabbit Polyclonal Antibody
TA307945

USD 625.00

In Stock

Rabbit Polyclonal antibody to MGAT3 (mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase)

Applications IF, IHC, WB
Reactivities Human (Predicted: Chicken)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 260 and 525 of MGAT3 (Uniprot ID#Q09327)
Ribophorin II (RPN2) Rabbit Polyclonal Antibody
TA590669

USD 482.00

In Stock

Rabbit Polyclonal Ribophorin II Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
ALG6 Rabbit Polyclonal Antibody
TA341915

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALG6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALG6 antibody: synthetic peptide directed towards the N terminal of human ALG6. Synthetic peptide located within the following region: YEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVA
B4GALT3 Rabbit Polyclonal Antibody
TA314795

USD 380.00

In Stock

Rabbit polyclonal anti-B4GALT3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B4GALT3.
DPAGT1 Rabbit Polyclonal Antibody
TA338275

USD 539.00

5 Days

Rabbit Polyclonal Anti-DPAGT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPAGT1 antibody is: synthetic peptide directed towards the C-terminal region of Human DPAGT1. Synthetic peptide located within the following region: TKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLG
CDw75 (ST6GAL1) Rabbit Polyclonal Antibody
AP31619PU-N

USD 535.00

2 Weeks

CDw75 (ST6GAL1) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to the Internal region of Human ST6GAL1.
B4GALT1 Rabbit Polyclonal Antibody
TA313920

USD 380.00

4 Weeks

Rabbit polyclonal anti-B4GALT1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human B4GALT1.
alpha Glucosidase II (GANAB) Rabbit Polyclonal Antibody
TA308533

USD 625.00

5 Days

Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Monkey, Pig, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697)
TUSC3 Rabbit Polyclonal Antibody
TA312791

USD 380.00

4 Weeks

Rabbit polyclonal anti-TUSC3 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TUSC3.