Antibodies

Jump to Filters
View as table Download
IRF1 Rabbit Polyclonal Antibody
TA323047

USD 380.00

2 Weeks

Anti-IRF1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 220-233 amino acids of human interferon regulatory factor 1
IRF1 Rabbit Polyclonal Antibody
TA341784

USD 539.00

5 Days

Rabbit Polyclonal Anti-Irf1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Irf1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: HIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRGDIGIGIQHVFTEMK
IRF1 Rabbit Polyclonal Antibody
TA341785

USD 539.00

5 Days

Rabbit Polyclonal Anti-Irf1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Irf1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPT