Antibodies

Jump to Filters
View as table Download
Estrogen Related Receptor beta (ESRRB) Rabbit Polyclonal Antibody
TA319646

USD 570.00

2 Weeks

Rabbit Polyclonal ESRRB Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ESRRB antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ESRRB.
Estrogen Related Receptor beta (ESRRB) Rabbit Polyclonal Antibody
TA330220

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-ESRRB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS
Estrogen Related Receptor beta (ESRRB) Rabbit Polyclonal Antibody
TA329374

USD 539.00

5 Days

Rabbit Polyclonal anti-ESRRB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: RHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANG