Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 702 results

Page 1 of 47

(reset)

BIRC5 Rabbit Polyclonal Antibody

TA301775

USD 550.00

5 Days

Rabbit Polyclonal Antibody against Survivin - Astrocyte Marker

Applications	ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities	Human, Mouse, Rat, Feline, Dog
Conjugation	Unconjugated
Immunogen	Full-length recombinant human survivin.

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

beta Catenin (CTNNB1) (C-term) Rabbit Polyclonal Antibody

AP51124PU-N

USD 580.00

2 Weeks

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.

1 / 3

2 / 3

3 / 3

Previous Next

BAX Rabbit Polyclonal Antibody

TA590174

USD 482.00

In Stock

Rabbit Polyclonal Bax Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Caspase 9 (CASP9) Rabbit Polyclonal Antibody

TA312629

USD 380.00

In Stock

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human Caspase 9.

1 / 2

2 / 2

Previous Next

MLH1 Rabbit Polyclonal Antibody

TA590013

USD 482.00

In Stock

Rabbit Polyclonal MLH1 Antibody

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the Middle Region of the target protein.

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

EGFR Rabbit Polyclonal Antibody

TA312545

USD 380.00

4 Weeks

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

1 / 3

2 / 3

3 / 3

Previous Next

ERK1 (MAPK3) Rabbit Polyclonal Antibody

TA324783

USD 580.00

2 Weeks

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications	Dot, WB
Reactivities	Human (Predicted: Mouse, Rat, Drosophila)
Conjugation	Unconjugated
Immunogen	This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

SMAD3 Rabbit Polyclonal Antibody

TA325852

USD 380.00

4 Weeks

Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8
Modifications	Phospho-specific

RAC1 Rabbit Polyclonal Antibody

TA327599

USD 450.00

In Stock

Phospho-RAC1-S71 Rabbit Polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A phospho specific peptide corresponding to residues surrounding S71 of human RAC1

c-Myc (MYC) Rabbit Polyclonal Antibody

TA336686

USD 550.00

5 Days

Rabbit Polyclonal c-Myc Antibody

Applications	ChIP, ELISA, ICC/IF, IHC, IP, Simple Western, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

AKT1 Rabbit Polyclonal Antibody

TA313266

USD 380.00

2 Weeks

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications	Phospho-specific

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

AKT2 Rabbit Polyclonal Antibody

TA590729

USD 482.00

In Stock

Rabbit Polyclonal AKT2 Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Frizzled 9 (FZD9) Rabbit Polyclonal Antibody

TA314730

USD 380.00

2 Weeks

Rabbit polyclonal anti-FZD9 antibody

Applications	IF, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9.

1 / 2

2 / 2

Previous Next

p53 (TP53) Rabbit Polyclonal Antibody

TA329140

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Frizzled 7 (FZD7) Rabbit Polyclonal Antibody

TA344065

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-FZD7 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV

1 / 2

2 / 2

Previous Next

1 - 15 of 702 results

Page 1 of 47