Antibodies

Jump to Filters
View as table Download
Integrin beta 7 (ITGB7) Rabbit Polyclonal Antibody
TA351299

USD 380.00

In Stock

Rabbit Polyclonal Anti-ITGB7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGB7
CD42b (GP1BA) Rabbit Polyclonal Antibody
TA350034

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-GP1BA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GP1BA
CD41 (ITGA2B) Rabbit Polyclonal Antibody
TA308579

USD 625.00

5 Days

Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))

Applications IHC, WB
Reactivities Human (Predicted: Dog, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514)
Syndecan 4 (SDC4) Rabbit Polyclonal Antibody
TA314520

USD 380.00

In Stock

Rabbit polyclonal Syndecan4 (Ab-179) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D).
Integrin alpha 4 (ITGA4) Rabbit Polyclonal Antibody
TA306659

USD 570.00

2 Weeks

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4.
CD44 Rabbit Polyclonal Antibody
TA325323

USD 380.00

In Stock

Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706
Modifications Phospho-specific
Integrin alpha 5 (ITGA5) (Center) Rabbit Polyclonal Antibody
AP52251PU-N

USD 580.00

2 Weeks

Integrin alpha 5 (ITGA5) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 574-602 amino acids from the Central region of Human CD49e / ITGA5
CD42a (GP9) Rabbit Polyclonal Antibody
TA332651

USD 365.00

3 Weeks

Rabbit anti-GP9 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GP9
Syndecan 4 (SDC4) Rabbit Polyclonal Antibody
TA347799

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Syndecan4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Syndecan4 Antibody: A synthesized peptide derived from human Syndecan4
Syndecan 2 (SDC2) Rabbit Polyclonal Antibody
TA314519

USD 380.00

In Stock

Rabbit polyclonal anti-SDC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SDC2.
SV2A Rabbit Polyclonal Antibody
TA341964

USD 539.00

5 Days

Rabbit Polyclonal Anti-SV2A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SV2A antibody: synthetic peptide directed towards the middle region of human SV2A. Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT