Antibodies

Jump to Filters
View as table Download
Glucose Transporter GLUT1 (SLC2A1) Rabbit Polyclonal Antibody
TA301678

USD 620.00

2 Weeks

Rabbit Polyclonal Antibody against GLUT1

Applications ChIP, FC, ICC/IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166]
glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody
TA334652

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
AKT1 Rabbit Polyclonal Antibody
TA313266

USD 380.00

2 Weeks

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific
JNK1 (MAPK8) Rabbit Polyclonal Antibody
TA325663

USD 380.00

4 Weeks

Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185
Modifications Phospho-specific
Glucose Transporter GLUT1 (SLC2A1) Rabbit Polyclonal Antibody
TA312796

USD 380.00

4 Weeks

Rabbit polyclonal anti-GLUT1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GLUT1.
AKT1 Rabbit Polyclonal Antibody
TA311645

USD 380.00

In Stock

Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A).
AKT1 Rabbit Polyclonal Antibody
TA313265

USD 380.00

4 Weeks

Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C).
Modifications Phospho-specific
JNK1 (MAPK8) Rabbit Polyclonal Antibody
TA325661

USD 380.00

4 Weeks

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3
Glucose Transporter GLUT1 (SLC2A1) Rabbit Polyclonal Antibody
TA325843

USD 380.00

4 Weeks

Rabbit Polyclonal GLUT1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human GLUT1.