Antibodies

View as table Download

Anti-SERPINB5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-SERPINB5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal MASPIN Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit polyclonal Maspin Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This Maspin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 94-123 amino acids from the Central region of human Maspin.

Rabbit Polyclonal MASPIN Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 100-200). [Swiss-Prot# P36952]

Rabbit Polyclonal Anti-SERPINB5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINB5 antibody: synthetic peptide directed towards the middle region of human SERPINB5. Synthetic peptide located within the following region: NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM

Rabbit polyclonal anti-Serpin B5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Serpin B5.

SERPINB5 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human SERPINB5