Antibodies

Jump to Filters
View as table Download
NDUFS3 Rabbit Polyclonal Antibody
TA350215

USD 380.00

In Stock

Rabbit Polyclonal Anti-NDUFS3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFS3
NDUFS3 Rabbit Polyclonal Antibody
TA342216

USD 539.00

5 Days

Rabbit polyclonal Anti-NDUFS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: ANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQ
NDUFS3 Rabbit Polyclonal Antibody
TA342217

USD 539.00

5 Days

Rabbit polyclonal Anti-NDUFS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK