NDUFS3 Rabbit Polyclonal Antibody

CAT#: TA342216

Rabbit polyclonal Anti-NDUFS3 Antibody

Product Images

WB Suggested Anti-NDUFS3 Antibody Titration: 0.2-1 ug/ml; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: ANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: NADH:ubiquinone oxidoreductase core subunit S3
• Database Link:
  NP_004542
  Entrez Gene 4722 Human
  UniProt ID O75489
• Background: This gene encodes one ofThe iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations inThis gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency. [provided by RefSeq, Apr 2009]
• Synonyms: CI-30
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease