Antibodies

Jump to Filters
View as table Download
NDUFB10 Rabbit Polyclonal Antibody
TA312943

USD 380.00

In Stock

Rabbit polyclonal anti-NDUFB10 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFB10.
NDUFB10 Rabbit Polyclonal Antibody
TA325189

USD 580.00

5 Days

Rabbit polyclonal NDUFB10 Antibody (Center)

Applications WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This NDUFB10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 43-70 amino acids from the Central region of human NDUFB10.
NDUFB10 Rabbit Polyclonal Antibody
TA343253

USD 539.00

5 Days

Rabbit Polyclonal Anti-NDUFB10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFB10 antibody is: synthetic peptide directed towards the C-terminal region of NDUFB10. Synthetic peptide located within the following region: KVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL