Antibodies

Jump to Filters
View as table Download
BMP6 Rabbit Polyclonal Antibody
AP20577PU-N

USD 445.00

3 Weeks

BMP6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6.
BMP4 Rabbit Polyclonal Antibody
TA323209

USD 380.00

2 Weeks

Anti-BMP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4
BMP6 Rabbit Polyclonal Antibody
TA351009

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-BMP6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human BMP6
BMP2 (aa 261-290) Rabbit Polyclonal Antibody
AP20597PU-N

USD 445.00

3 Weeks

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.
BMP2 Rabbit Polyclonal Antibody
TA336740

USD 550.00

2 Weeks

Rabbit Polyclonal BMP-2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]
BMP4 Rabbit Polyclonal Antibody
TA323208

USD 380.00

In Stock

Anti-BMP4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4
WNT5A Rabbit Polyclonal Antibody
TA337059

USD 550.00

5 Days

Rabbit Polyclonal Wnt-5a Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2.
BMP7 Rabbit Polyclonal Antibody
AP20768PU-N

USD 465.00

3 Weeks

BMP7 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide cooresponding aa 140-190 of human BMP7
BMP7 Rabbit Polyclonal Antibody
TA326853

USD 365.00

2 Weeks

Rabbit anti-BMP7 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP7
BMP2 Rabbit Polyclonal Antibody
TA890048

USD 407.00

In Stock

Rabbit polyclonal anti-BMP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP2
BMP5 Rabbit Polyclonal Antibody
TA343342

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-BMP5 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Bmp5 antibody is: synthetic peptide directed towards the C-terminal region of Rat Bmp5. Synthetic peptide located within the following region: NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG
WNT1 Rabbit Polyclonal Antibody
TA319438

USD 765.00

5 Days

Rabbit polyclonal anti-Wnt1 antibody

Applications WB
Reactivities Mouse, Human, Bovine, Dog, Macaque, Rat, Opossum
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein.
BMP6 Rabbit Polyclonal Antibody
TA344216

USD 539.00

5 Days

Rabbit Polyclonal Anti-BMP6 Antibody - middle region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL