Germany
Japan
United Kingdom
China
USD 380.00
2 Weeks
Antibodies
View as table Download
Rabbit Polyclonal antibody to B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 122 and 338 of B3GNT3 (Uniprot ID#Q9Y2A9) |
Rabbit Polyclonal Anti-ST3GAL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST3GAL4 antibody: synthetic peptide directed towards the middle region of human ST3GAL4. Synthetic peptide located within the following region: IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM |
Rabbit polyclonal anti-B4GALT1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human B4GALT1. |
Rabbit Polyclonal Anti-B3galt2 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-B3galt2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNK |
Rabbit Polyclonal Anti-ST3GAL4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST3GAL4 antibody: synthetic peptide directed towards the middle region of human ST3GAL4. Synthetic peptide located within the following region: FDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDV |
Rabbit Polyclonal Anti-B3GALT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-B3GALT1 antibody: synthetic peptide directed towards the N terminal of human B3GALT1. Synthetic peptide located within the following region: MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTF |
Rabbit Polyclonal Anti-B3GALT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-B3GALT1 antibody: synthetic peptide directed towards the C terminal of human B3GALT1. Synthetic peptide located within the following region: YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI |
Active filters
Category
- Antibodies
Applications
- WB
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated
Pathways
- Glycosphingolipid biosynthesis - lacto and neolacto series