Antibodies

Jump to Filters
View as table Download
IRF1 Rabbit Polyclonal Antibody
TA323047

USD 380.00

2 Weeks

Anti-IRF1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 220-233 amino acids of human interferon regulatory factor 1
IRF1 Rabbit Polyclonal Antibody
TA335846

USD 539.00

5 Days

Rabbit Polyclonal Anti-IRF1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF1 Antibody: synthetic peptide directed towards the N terminal of human IRF1. Synthetic peptide located within the following region: MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINK
IRF1 (Center) Rabbit Polyclonal Antibody
AP52233PU-N

USD 580.00

2 Weeks

IRF1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 81-110 amino acids from the Central region of Human IRF1
IRF1 (C-term) Rabbit Polyclonal Antibody
AP52234PU-N

USD 580.00

2 Weeks

IRF1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 266-293 amino acids from the C-terminal region of Human IRF1
IRF1 Rabbit Polyclonal Antibody
TA329237

USD 539.00

5 Days

Rabbit Polyclonal anti-IRF1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF1 antibody: synthetic peptide directed towards the N terminal of human IRF1. Synthetic peptide located within the following region: RMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPD
IRF1 Rabbit Polyclonal Antibody
TA335847

USD 539.00

5 Days

Rabbit Polyclonal Anti-IRF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF1 Antibody is: synthetic peptide directed towards the C-terminal region of IRF1. Synthetic peptide located within the following region: YLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATW
IRF1 Rabbit Polyclonal Antibody
TA341784

USD 539.00

5 Days

Rabbit Polyclonal Anti-Irf1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Irf1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: HIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRGDIGIGIQHVFTEMK
IRF1 Rabbit Polyclonal Antibody
TA341785

USD 539.00

5 Days

Rabbit Polyclonal Anti-Irf1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Irf1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPT
IRF1 Rabbit Polyclonal Antibody
TA356330

USD 539.00

5 Days

IRF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human IRF1