Rabbit Polyclonal Anti-GLUD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER |
Rabbit Polyclonal Anti-GLUD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF |
Germany
Japan
United Kingdom
China
