Rabbit polyclonal Anti-Sema3f Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH |
Rabbit anti-GNAS Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAS |
Rabbit anti-TFRC Polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFRC |
Germany
Japan
United Kingdom
China
