Antibodies

Jump to Filters
View as table Download
Semaphorin 3F (SEMA3F) Rabbit Polyclonal Antibody
TA342215

USD 539.00

2 Weeks

Rabbit polyclonal Anti-Sema3f Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH
CDK5 Rabbit Polyclonal Antibody
TA332868

USD 450.00

3 Weeks

Rabbit anti-CDK5 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDK5