Rabbit Polyclonal antibody to Triosephosphate isomerase (triosephosphate isomerase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Yeast, Dog, Chicken, Chimpanzee, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 187 and 249 of Triosephosphate isomerase (Uniprot ID#P60174) |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast |
| Conjugation | Unconjugated |
| Immunogen | Recombinant human Caspase-3 protein (full length) |
ARX1 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from N-term domain of ARX1 |
ADH1 rabbit polyclonal antibody, HRP, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Yeast |
| Conjugation | HRP |
| Immunogen | Alcohol dehydrogenase from yeast |
REI1 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from C-term domain of REI1 from Saccharomyces cerevisiae (Baker's yeast) |
PTC2 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from the C-terminal domain of PP2C2 |
Germany
Japan
United Kingdom
China
