Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-PAFAH1B1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 61-74 amino acids of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) |
USD 380.00
In Stock
Anti-PAFAH1B1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 61-74 amino acids of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) |
Rabbit polyclonal PLA2G7 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLA2G7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the Central region of human PLA2G7. |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Rabbit polyclonal PLD2 (Tyr169) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLD2 around the phosphorylation site of tyrosine 169 (E-N-YP-L-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-PLA2G4E antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PLA2G4E. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Antibody Hosts
- Rabbit
Isotypes
- IgG
Pathways
- Ether lipid metabolism