Antibodies

Jump to Filters
View as table Download
WNT11 Rabbit Polyclonal Antibody
TA308507

USD 625.00

3 Weeks

Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014)
Frizzled 7 (FZD7) Rabbit Polyclonal Antibody
TA344065

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-FZD7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
VANGL1 Rabbit Polyclonal Antibody
TA324043

USD 380.00

In Stock

Anti-VANGL1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 248-524 amino acids of human VANGL planar cell polarity protein 1
VANGL1 Rabbit Polyclonal Antibody
TA324042

USD 380.00

In Stock

Anti-VANGL1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 248-524 amino acids of human VANGL planar cell polarity protein 1
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
TA306424

USD 570.00

In Stock

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.
Frizzled 8 (FZD8) Rabbit Polyclonal Antibody
TA322154

USD 380.00

In Stock

Anti-FZD8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 680-694 amino acids of human frizzled family receptor 8
Frizzled 8 (FZD8) Rabbit Polyclonal Antibody
TA322155

USD 380.00

In Stock

Anti-FZD8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 680-694 amino acids of human frizzled family receptor 8
FZD3 Rabbit Polyclonal Antibody
TA322315

USD 380.00

In Stock

Anti-FZD3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 133-147 amino acids of human frizzled family receptor 3
Frizzled 10 (FZD10) Rabbit Polyclonal Antibody
TA322436

USD 380.00

In Stock

Anti-FZD10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 171-185 amino acids of human frizzled family receptor 10
SFRP1 Rabbit Polyclonal Antibody
TA322916

USD 380.00

In Stock

Anti-SFRP1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 42-58 amino acids of Human secreted frizzled-related protein 1
SFRP1 Rabbit Polyclonal Antibody
TA322918

USD 380.00

In Stock

Anti-SFRP1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 287-300 amino acids of human secreted frizzled-related protein 1
LRP5 Rabbit Polyclonal Antibody
TA323024

USD 380.00

In Stock

Anti-LRP5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1178-1190 amino acids of Human low density lipoprotein receptor-related protein 5
Frizzled 6 (FZD6) Rabbit Polyclonal Antibody
TA324004

USD 380.00

In Stock

Anti-FZD6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 47-60 amino acids of human frizzled family receptor 6
WNT11 Rabbit Polyclonal Antibody
TA349514

USD 380.00

In Stock

Rabbit Polyclonal Anti-WNT11 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT11
Frizzled homolog 1 (FZD1) Rabbit Polyclonal Antibody
TA350749

USD 380.00

In Stock

Rabbit Polyclonal Anti-FZD1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FZD1