Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 46 and 344 of ALPPL2 (Uniprot ID#P10696) |
Rabbit polyclonal ALPL Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ALPL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 217-246 amino acids from the Central region of human ALPL. |
Anti-GCH1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 51-64 amino acids of human GTP cyclohydrolase 1 |
Rabbit Polyclonal antibody to SPR (sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase))
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 65 and 261 of SPR (Uniprot ID#P35270) |
Rabbit Polyclonal antibody to PTS (6-pyruvoyltetrahydropterin synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 145 of PTS (Uniprot ID#Q03393) |
Rabbit polyclonal antibody to alkaline phosphatase(intestinal) (alkaline phosphatase, intestinal)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 3 and 206 of Alkaline phosphatase (intestinal) (Uniprot ID#P09923) |
Rabbit Polyclonal Anti-ALPP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALPP antibody: synthetic peptide directed towards the C terminal of human ALPP. Synthetic peptide located within the following region: TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA |
Germany
Japan
United Kingdom
China
