Antibodies

Jump to Filters
View as table Download
MSH2 Rabbit Polyclonal Antibody
TA313355

USD 380.00

4 Weeks

Rabbit polyclonal anti-MSH2 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MSH2.
MSH2 Rabbit Polyclonal Antibody
TA346018

USD 539.00

5 Days

Rabbit Polyclonal Anti-MSH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG