Antibodies

Jump to Filters
View as table Download
Fumarylacetoacetate hydrolase (FAH) Rabbit Polyclonal Antibody
TA346161

USD 485.00

5 Days

Rabbit Polyclonal Anti-FAH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH. Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG
Fumarylacetoacetate hydrolase (FAH) Rabbit Polyclonal Antibody
TA346160

USD 539.00

5 Days

Rabbit Polyclonal Anti-FAH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FAH antibody: synthetic peptide directed towards the N terminal of human FAH. Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT
Fumarylacetoacetate hydrolase (FAH) Rabbit Polyclonal Antibody
TA354752

USD 425.00

2 Weeks

Rabbit anti FAH (Fumarylacetoacetat Hydrolase) Polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen A full length recombinant protein of FAH from mouse origin
Fumarylacetoacetate hydrolase (FAH) (N-term) Rabbit Polyclonal Antibody
AP51509PU-N

USD 580.00

2 Weeks

Fumarylacetoacetate hydrolase (FAH) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 14-41 amino acids from the N-terminal region of human FAH