Rabbit Polyclonal Anti-GABRB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GABRB1 |
Rabbit Polyclonal Anti-GABRB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GABRB1 |
Rabbit Polyclonal Anti-GABRA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GABRA1 |
Rabbit Polyclonal 5-HT3A Antibody
Applications | IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 27-42 (RATQAHSTTQPALLRL) and 427-442 (LSSIRHSLEKRDEMRE) of rat 5-HT3 Receptor, accession number P35563. |
Rabbit Polyclonal Anti-CHRNA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CHRNA1 |
Anti-GLRA1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 141-155 amino acids of human glycine receptor, alpha 1 |
Anti-HTR3A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 322-455 amino acids of human 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic |
Anti-CHRNA3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 69-83 amino acids of Human cholinergic receptor, nicotinic, alpha 3 (neuronal) |
USD 850.00
3 Weeks
Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor alpha 4 (extracellular
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DLVNMHSRVDQLD, corresponding to amino acid residues 190-202 of human nAChRa4. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-GAMT Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GLRA1 |
Rabbit polyclonal GABRA2 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | This GABRA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-406 amino acids from the C-terminal region of human GABRA2. |
Rabbit Polyclonal Anti-GABA (A) alpha3 Receptor (extracellular)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide QGESRRQEPGDFVKQ(C), corresponding to amino acid residues 29-43 of human GABA (A) a3 Receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-GABRG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GABRG2 |
Rabbit Polyclonal Anti-GABRD Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG |
CHRNA1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of Human CHRNA1, identical to the related Rat and Mouse sequence |
GABA A Receptor alpha 1 (GABRA1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |