Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Pig, Rat, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit Polyclonal antibody to O-GlcNAc transferase (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 223 and 502 of O-GlcNAc transferase (Uniprot ID#O15294) |
Rabbit Polyclonal antibody to Creatine kinase (brain) (creatine kinase, brain)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Bovine, Chicken, Pig, Rabbit, Xenopus, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 165 and 381 of Creatine kinase (brain) (Uniprot ID#P12277) |
Rabbit polyclonal GC Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Bovine, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC. |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chicken, Dog, Pig, Rabbit, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 23 and 218 of HPRT (Uniprot ID#P00492) |
Rabbit Polyclonal Anti-CPS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the middle region of human CPS1. Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI |
Rabbit polyclonal GALNS Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This GALNS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-263 amino acids from the Central region of human GALNS. |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chicken, Dog, Pig, Rabbit, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 218 of HPRT (Uniprot ID#P00492) |
Rabbit polyclonal GAD2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This GAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 109-138 amino acids from the Central region of human GAD2. |
Rabbit Polyclonal antibody to O-GlcNAc transferase (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase))
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Xenopus, Pig, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 280 of O-GlcNAc transferase (Uniprot ID#O15294) |
Rabbit polyclonal PI3KC3 Antibody (S34)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Pig, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This PI3KC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 14-39 amino acids from human PI3KC3. |
Rabbit polyclonal antibody to Pancreatic Lipase (pancreatic lipase)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Pig, Rabbit, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 21 and 300 of Pancreatic Lipase (Uniprot ID#P16233) |
Rabbit Polyclonal antibody to PON2 (paraoxonase 2)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Dog, Pig, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 295 of PON2 (Uniprot ID#Q15165) |
Rabbit polyclonal OTC Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This OTC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the Central region of human OTC. |
Germany
Japan
United Kingdom
China
