Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
| Applications | IF, IHC, WB |
| Reactivities | Human, Drosophila, Rat, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, C. elegans) |
| Conjugation | Unconjugated |
| Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
Rabbit Polyclonal Anti-TUBE1 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Drosophila, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA |
Germany
Japan
United Kingdom
China
