Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to AChE (acetylcholinesterase (Yt blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 406 and 614 of AChE (Uniprot ID#P22303) |
Rabbit polyclonal ACHE Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACHE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-175 amino acids from the N-terminal region of human ACHE. |
Rabbit polyclonal LCAT Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LCAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 285-313 amino acids from the Central region of human LCAT. |
Rabbit Polyclonal Anti-ACHE Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACHE antibody: synthetic peptide directed towards the N terminal of human ACHE. Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Rabbit Polyclonal Anti-DGKH Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Glycerophospholipid metabolism