Rabbit Polyclonal Calnexin Antibody
| Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565] |
Rabbit Polyclonal ABCA1 Antibody
| Applications | Block/Neutralize, ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information. |
Rabbit Polyclonal SR-BI Antibody
| Applications | Block/Neutralize, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Hamster, Mustelid |
| Conjugation | Unconjugated |
| Immunogen | A C-terminal peptide containing residues from mouse SR-BI (within residues 450-509). [UniProt# Q61009] |
Rabbit Polyclonal Niemann-Pick C1 Antibody
| Applications | Electron Microscopy, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118] |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey, Pig, Horse (Predicted: Bovine, Hamster, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
Rabbit Polyclonal Anti-NMBR Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human (Predicted: Monkey, Rat, Dog, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | NMBR antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human NMBR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Panda, Bovine, Bat, Horse, Rabbit, Pig (100%); Marmoset, Rat, Hamster, Dog, Opossum (94%); Platypus (88%); Elephant, Xenopus (81%). |
XPR1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Bovine, Bat, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic 16 amino acid peptide from the N-terminal cytoplasmic domain of human XPR1. |
USD 515.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey, Gibbon, Orang-Utan (Predicted: Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
FKSG80 / GPR81 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Dog, Gorilla, Human, Monkey, Rabbit, Rat, Hamster (Predicted: Mouse, Horse, Pig) |
| Conjugation | Unconjugated |
| Immunogen | FKSG80 / GPR81 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human GPR81. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Rat, Dog, Bat, Hamster, Panda, Rabbit, Opossum (100%); Mouse, Horse, Pig, Platypus (94%); Bovine (88%); Elephant (81%). |
CNR2 / CB2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Dog, Gorilla, Human, Monkey, Gibbon (Predicted: Mouse, Rat, Bat, Hamster, Horse) |
| Conjugation | Unconjugated |
| Immunogen | CNR2 / CB2 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human CNR2 / CB2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog (100%); Mouse, Rat, Elephant, Panda (95%); Hamster, Bat, Horse (90%); Rabbit (85%). |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human (Predicted: Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Gorilla, Human, Monkey, Gibbon (Predicted: Mouse, Rat, Bat, Hamster, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Dog, Bovine (100%); Mouse, Rat, Hamster, Bat, Rabbit (94%); Opossum (81%). |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Dog, Gorilla, Human, Monkey, Rabbit, Gibbon (Predicted: Rat, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Rabbit (100%); Rat, Hamster, Opossum (94%). |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Germany
Japan
United Kingdom
China
