Antibodies

Jump to Filters
View as table Download
COX11 Rabbit Polyclonal Antibody
TA323960

USD 380.00

2 Weeks

Anti-COX11 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 115-276 amino acids of human cytochrome c oxidase assembly homolog 11 (yeast)
Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody
TA335305

USD 539.00

5 Days

Rabbit Polyclonal Anti-UCRC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK