Antibodies

Jump to Filters
View as table Download
G0 Protein alpha (GNAO1) Rabbit Polyclonal Antibody
TA333538

USD 539.00

5 Days

Rabbit Polyclonal Anti-GNAO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNAO1 Antibody: synthetic peptide directed towards the middle region of human GNAO1. Synthetic peptide located within the following region: CDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYL
G0 Protein alpha (GNAO1) (345-354) Rabbit Polyclonal Antibody
AP22815PU-N

USD 500.00

2 Weeks

G0 Protein alpha (GNAO1) (345-354) rabbit polyclonal antibody, Ig Fraction

Applications ELISA, IHC, WB
Reactivities Mouse, Drosophila
Conjugation Unconjugated
Immunogen Synthetic peptide KLH- conjugated corresponding to amino acids 345-354 of the native molecule