Antibodies

Jump to Filters
View as table Download
PTCH1 Rabbit Polyclonal Antibody
TA385073

USD 380.00

4 Weeks

PTCH1 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Patched. AA range:1-50
PTCH1 Rabbit Polyclonal Antibody
TA380484

USD 365.00

3 Weeks

PTCH1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1214-1312 of human PTCH1 (NP_000255.2).
Modifications Unmodified
PTCH1 Rabbit Polyclonal Antibody
TA334665

USD 539.00

5 Days

Rabbit Polyclonal Anti-PTCH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTCH1 antibody: synthetic peptide directed towards the C terminal of human PTCH1. Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM