Rabbit Polyclonal PON1 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Dog, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal PON1 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Dog, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172) |
Rabbit Polyclonal Anti-DBH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DBH |
Rabbit Polyclonal Anti-HYAL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HYAL3 |
Rabbit Polyclonal Anti-PON1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PON1 |
Rabbit Polyclonal antibody to GALNT2 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 55 and 369 of GALNT2 (Uniprot ID#Q10471) |
Rabbit Polyclonal Anti-HYAL1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HYAL1 antibody: synthetic peptide directed towards the N terminal of human HYAL1. Synthetic peptide located within the following region: WNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYY |
Rabbit polyclonal anti-ST6GAL1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ST6GAL1. |
Rabbit polyclonal antibody to ST3GAL1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 195 of SIAT4A (Uniprot ID#Q11201) |
Rabbit Polyclonal Anti-ABO Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABO |
Rabbit Polyclonal Antibody against Endothelial Lipase
Applications | ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A C-terminal synthetic peptide made to the human endothelial lipase protein sequence. |
Rabbit polyclonal PLA2G7 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PLA2G7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the Central region of human PLA2G7. |
Rabbit Polyclonal Anti-AMY2A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AMY2A |
Rabbit Polyclonal Anti-CNDP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CNDP1 |
Rabbit Polyclonal Anti-PNLIP Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PNLIP |