Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Pig, Rat, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal Anti-GSR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Rat, Zebrafish, Xenopus, Pig, Chicken, Sheep, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit polyclonal antibody to RAB6A (RAB6A, member RAS oncogene family)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chicken, Pig, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 208 of RAB6A (Uniprot ID#P20340) |
Rabbit Polyclonal antibody to TBCK (TBC1 domain containing kinase)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chicken, Rat, Xenopus, Zebrafish, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 457 and 694 of TBCK (Uniprot ID#Q8TEA7) |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chicken, Dog, Pig, Rabbit, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 23 and 218 of HPRT (Uniprot ID#P00492) |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Monkey, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Dog, Pig, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062) |
Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Rat, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398) |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Chicken, Dog, Pig, Rabbit, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 218 of HPRT (Uniprot ID#P00492) |
Rabbit Polyclonal antibody to Transmembrane protein 147 (transmembrane protein 147)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Zebrafish, Xenopus, Bovine, Rhesus Monkey, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 37 and 131 of Transmembrane protein 147 (Uniprot ID#Q9BVK8) |
Rabbit polyclonal EN2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Zebrafish, Chicken, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This EN2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-271 amino acids from the C-terminal region of human EN2. |
Rabbit Polyclonal antibody to DUSP7 (dual specificity phosphatase 7)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 258 and 350 of DUSP7 (Uniprot ID#Q16829) |
Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Zebrafish, Chicken, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980) |
Rabbit polyclonal METTL2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This METTL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 329-359 amino acids from the C-terminal region of human METTL2. |
Germany
Japan
United Kingdom
China
