Antibodies

View as table Download

Rabbit Polyclonal Calreticulin Antibody

Applications Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Hamster, Primate
Conjugation Unconjugated
Immunogen A fusion protein to mouse Calreticulin [UniProt# P14211]

Rabbit Polyclonal MUC-1 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

SFTPC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Bovine, Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human SFTPC.

Rabbit polyclonal IGFBP2 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Bovine, Pig)
Conjugation Unconjugated
Immunogen This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2.

Prealbumin (TTR) (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human, Bovine
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 47-74 amino acids from the Central region of human TTR.