Antibodies

Jump to Filters
View as table Download
EMA (MUC1) Rabbit Polyclonal Antibody
TA336810

USD 550.00

5 Days

Rabbit Polyclonal MUC-1 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
ACKR3 Rabbit Polyclonal Antibody
TA337066

USD 550.00

5 Days

Rabbit Polyclonal CXCR7/RDC-1 Antibody

Applications FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1.
TLR7 (900-950) Rabbit Polyclonal Antibody
AP23604PU-N

USD 535.00

2 Weeks

TLR7 (900-950) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Bovine, Canine, Equine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide from a portion of amino acids 900-950 of Human TLR7