Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SIAH2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIAH2 antibody: synthetic peptide directed towards the N terminal of human SIAH2. Synthetic peptide located within the following region: SRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAA

Rabbit Polyclonal Anti-SIAH2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIAH2

SIAH2 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal SIAH2 Antibody (24E6H3)

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Drosophila, Porcine (Does not react with: Mouse)
Conjugation Unconjugated

Rabbit Polyclonal Anti-SIAH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIAH2 Antibody: synthetic peptide directed towards the middle region of human SIAH2. Synthetic peptide located within the following region: AVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYR

Rabbit polyclonal anti-SIAH2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SIAH2.

SIAH2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human SIAH2

SIAH2 rabbit polyclonal antibody, Serum

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from N-terminal region of SIAH-2