Rabbit Polyclonal antibody to TTC30A (tetratricopeptide repeat domain 30A)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 347 and 665 of TTC30A (Uniprot ID#Q86WT1) |
Rabbit Polyclonal Anti-TTC30A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TTC30A antibody is: synthetic peptide directed towards the C-terminal region of Human TTC30A. Synthetic peptide located within the following region: IEKEEEQLSYDDPNRKMYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEP |
Germany
Japan
United Kingdom
China
