Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Neurofilament M Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Neurofilament M (NP_005373.2). |
| Modifications | Unmodified |
USD 510.00
2 Weeks
Neurofilament (NEFM) (phosphospecific) mouse monoclonal antibody, clone RNF406, Purified
| Applications | IHC, WB |
| Reactivities | Guinea Pig, Hamster, Human, Monkey, Rabbit, Xenopus |
| Conjugation | Unconjugated |
Neurofilament (NEFM) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QASHITVERKDYLK, from the internal region of the protein sequence |
Neurofilament (NEFM) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Chicken Anti-Neurofilament NF-M ck Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Preparation containing the extreme C-terminus expressed in and purified from E. Coli |
Phospho-Neurofilament Medium (Ser614/Ser619) Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphopeptide corresponding to residues surrounding Ser614/Ser619 of human 160 kD Neurofilament Medium (Phosphorylated) |
Mouse Anti-Neurofilament NF-M ms Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Nefm Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Nefm antibody is: synthetic peptide directed towards the C-terminal region of Rat Nefm. Synthetic peptide located within the following region: GGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKEVTQ |
Neurofilament (NEFM) mouse monoclonal antibody, clone NF403, Supernatant
| Applications | IHC, WB |
| Reactivities | Bovine, Guinea Pig, Human, Rat |
| Conjugation | Unconjugated |
Neurofilament (NEFM) mouse monoclonal antibody, clone 403, Supernatant
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NEFM