TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TP53I3 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal antibody to PIG3 (tumor protein p53 inducible protein 3)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 332 of PIG3 (Uniprot ID#Q53FA7) |
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal PIG3 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Carrier-free (BSA/glycerol-free) TP53I3 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 509.00
2 Weeks
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-TP53I3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53I3 antibody is: synthetic peptide directed towards the C-terminal region of Human TP53I3. Synthetic peptide located within the following region: SKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVL |
TP53I3 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".