Mouse Monoclonal beta-Actin Antibody (8H10D10)
Applications | ELISA, FC, ICC/IF, Immunoblotting, WB |
Reactivities | Human, Mouse, Rat, Primate, Hamster |
Conjugation | Unconjugated |
Mouse Monoclonal beta-Actin Antibody (8H10D10)
Applications | ELISA, FC, ICC/IF, Immunoblotting, WB |
Reactivities | Human, Mouse, Rat, Primate, Hamster |
Conjugation | Unconjugated |
Rabbit Polyclonal beta-Actin Antibody
Applications | Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Porcine, Avian, Hamster |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709]. |
Rabbit Polyclonal Anti-KCNQ1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Hamster |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Mouse Monoclonal anti-KDELR1 Antibody
Applications | IF, WB |
Reactivities | Human, Monkey, Rat, Mouse, Rabbit, Porcine, Bovine, Sheep, Dog, Chicken, Xenopus, Hamster, Drosophila |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KCNQ1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Hamster |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS |
Mouse Monoclonal beta Actin Antibody
Applications | WB |
Reactivities | Human, Monkey, Rat, Mouse, Goat, Hamster |
Conjugation | Unconjugated |