Germany
Japan
United Kingdom
China
UBE1L2 / FLJ10808 Mouse Monoclonal (1D11) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
Rabbit Polyclonal FLJ10808 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 775-825 of human UBE1L2 was used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-UBA6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBA6 antibody: synthetic peptide directed towards the middle region of human UBA6. Synthetic peptide located within the following region: EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS |
UBA6 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human UBA6 |
Active filters
Target Symbol
- UBA6
Pathways
- Ubiquitin mediated proteolysis