UBE1L2 / FLJ10808 Mouse Monoclonal (1D11) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
UBE1L2 / FLJ10808 Mouse Monoclonal (1D11) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal FLJ10808 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 775-825 of human UBE1L2 was used as the immunogen for this antibody. |
Rabbit Polyclonal Anti-UBA6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBA6 antibody: synthetic peptide directed towards the middle region of human UBA6. Synthetic peptide located within the following region: EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS |
UBA6 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human UBA6 |