Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SGPL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SGPL1

SGPL1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from the sphingosine 1-phosphate lyase 1 protein.

SGPL1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of Human SGPL1.

Rabbit Polyclonal Anti-SGPL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGPL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SGPL1. Synthetic peptide located within the following region: IHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTT