Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Goat Anti-NDUFS3 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DTRPTVRPRNDVAHK, from the internal region of the protein sequence according to NP_004542.1. |
Rabbit polyclonal Anti-NDUFS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: ANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQ |
Rabbit polyclonal Anti-NDUFS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK |
Active filters
Target Symbol
- NDUFS3
Pathways
- Oxidative phosphorylation