Primary Antibodies

Jump to Filters
View as table Download
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA322463

USD 380.00

In Stock

Anti-YWHAQ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA322464

USD 380.00

In Stock

Anti-YWHAQ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA330345

USD 539.00

5 Days

Rabbit Polyclonal Anti-YWHAQ Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-YWHAQ antibody: synthetic peptide directed towards the N terminal of human YWHAQ. Synthetic peptide located within the following region: SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSIC
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
AP20329PU-N

USD 465.00

3 Weeks

14-3-3 theta (YWHAQ) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 200-240 of Human 14-3-3 θ.
14-3-3 theta (YWHAQ) Goat Polyclonal Antibody
TA303297

USD 520.00

In Stock

Goat Polyclonal Antibody against YWHAQ

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DDRKQTIDNSQ, from the internal region of the protein sequence according to NP_006817.1.
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA327381

USD 365.00

2 Weeks

YWHAQ Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human YWHAQ
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA312789

USD 380.00

4 Weeks

Rabbit polyclonal anti-14-3-3 theta antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 14-3-3 ?.
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA362521

USD 539.00

5 Days

YWHAQ Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human YWHAQ