Primary Antibodies

Jump to Filters
View as table Download
TRAR4 (TAAR6) Rabbit Polyclonal Antibody
TA337761

USD 539.00

5 Days

Rabbit Polyclonal Anti-TAAR6 Antibody

Applications IHC, WB
Reactivities Mouse, Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-TAAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR6. Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA